PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10012745m
Common NameCICLE_v10012556mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 212aa    MW: 24101.5 Da    PI: 7.1811
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10012745mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.73e-2998152155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+ Wt++LHe+Fve+v++LGGsekAtPk+il+lmk k L++ +vkSHLQkYR+
  Ciclev10012745m  98 KKRITWTKDLHEHFVECVNRLGGSEKATPKAILKLMKSKELSILQVKSHLQKYRS 152
                      68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.71495155IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2596153IPR009057Homeodomain-like
SuperFamilySSF466892.87E-1696152IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-2398153IPR006447Myb domain, plants
PfamPF002494.0E-8102151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MEAQSQEKQN LEPVIEASLP PSNQFSGDNF SEKLSELDTL ESLVLSSNHN RKFPRKISSI  60
PTPSESSQNT KNMSIFSSEE KQSCGLISDS YRHILSNKKR ITWTKDLHEH FVECVNRLGG  120
SEKATPKAIL KLMKSKELSI LQVKSHLQKY RSEKLISDQS LQGFPEKTVC INDIPQLYMK  180
MSMQIREALQ LQLELEKHLH DQLEACTSIE L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429842.11e-153hypothetical protein CICLE_v10012556mg
TrEMBLV4SQU11e-153V4SQU1_9R
STRINGPOPTR_0016s04830.15e-38(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.24e-30G2-like family protein